Primary Antibodies

View as table Download

Rabbit monoclonal antibody against PSMA (EP3253 )

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-FOLH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FOLH1 Antibody: synthetic peptide directed towards the C terminal of human FOLH1. Synthetic peptide located within the following region: FYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVA

Rabbit Polyclonal Anti-FOLH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FOLH1 Antibody is: synthetic peptide directed towards the middle region of Human FOLH1. Synthetic peptide located within the following region: FSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSV

FOLH1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human FOLH1