PSMA (FOLH1) Rabbit Polyclonal Antibody

CAT#: TA336088

Rabbit Polyclonal Anti-FOLH1 Antibody

Product Images

Host: Rabbit; Target Name: FOLH1; Sample Tissue: RPMI-8226 Whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FOLH1 Antibody is: synthetic peptide directed towards the middle region of Human FOLH1. Synthetic peptide located within the following region: FSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: folate hydrolase (prostate-specific membrane antigen) 1
• Database Link:
  NP_001014986
  Entrez Gene 2346 Human
  UniProt ID Q04609
• Background: This gene encodes a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different alternative substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-glutamate and is expressed in a number of tissues such as prostate, central and peripheral nervous system and kidney. A mutation in this gene may be associated with impaired intestinal absorption of dietary folates, resulting in low blood folate levels and consequent hyperhomocysteinemia. Expression of this protein in the brain may be involved in a number of pathological conditions associated with glutamate excitotoxicity. In the prostate the protein is up-regulated in cancerous cells and is used as an effective diagnostic and prognostic indicator of prostate cancer. This gene likely arose from a duplication event of a nearby chromosomal region.
• Synonyms: FGCP; FOLH; GCP2; GCPII; mGCP; NAALAD1; NAALAdase; PSM; PSMA
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 85%

Reference Data

• Protein Families: Druggable Genome, Protease, Transmembrane