Primary Antibodies

View as table Download

KCNMB3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNMB3

Rabbit polyclonal Anti-sloBeta3 (KCNMB3) (extracellular)

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)HYDEEAIRTNPK, corresponding to amino acid residues 134- 145 of rat SloÃ?3. Extracellular loop.

Rabbit Polyclonal Anti-KCNMB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNMB3 antibody: synthetic peptide directed towards the middle region of human KCNMB3. Synthetic peptide located within the following region: SLTLLGGALIVGMVRLTQHLSLLCEKYSTVVRDEVGGKVPYIEQHQFKLC

Rabbit Polyclonal Anti-KCNMB3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNMB3