Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PDGFD Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDGFD antibody: synthetic peptide directed towards the N terminal of human PDGFD. Synthetic peptide located within the following region: NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH

PDGFD Antibody - N-terminal region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse PDGFD