SCDGFB (PDGFD) Rabbit Polyclonal Antibody

CAT#: TA344192

Rabbit Polyclonal Anti-PDGFD Antibody - N-terminal region

Product Images

WB Suggested Anti-PDGFD Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PDGFD antibody: synthetic peptide directed towards the N terminal of human PDGFD. Synthetic peptide located within the following region: NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: platelet derived growth factor D
• Database Link:
  NP_079484
  Entrez Gene 80310 Human
  UniProt ID Q9GZP0
• Background: The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines, seven of which are f
• Synonyms: IEGF; MSTP036; SCDGF-B; SCDGFB
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Rabbit: 93%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Focal adhesion, Gap junction, Melanoma, Prostate cancer, Regulation of actin cytoskeleton