Primary Antibodies

View as table Download

Rabbit anti-PRNP Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRNP

Rabbit Polyclonal Prion protein Antibody

Applications WB
Reactivities Bovine, Sheep
Conjugation Unconjugated
Immunogen Amino acids 142-148 of BSE protein were used as the immunogen.

Rabbit Polyclonal Prion protein Antibody

Applications WB
Reactivities Bovine, Sheep, Avian
Conjugation Unconjugated
Immunogen Amino acids 162-170 of BSE protein were used as the immunogen.

Rabbit Polyclonal Prion protein Antibody

Applications WB
Reactivities Bovine, Sheep
Conjugation Unconjugated
Immunogen Amino acids 217-229 of BSE protein were used as the immunogen.

Rabbit Polyclonal Anti-PRNP Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Prnp antibody is: synthetic peptide directed towards the middle region of Mouse Prnp. Synthetic peptide located within the following region: GGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHF

PRNP rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PRNP

Prion Protein Rabbit polyclonal Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Prion Protein