Rabbit anti-SIRT7 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SIRT7 |
Rabbit anti-SIRT7 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SIRT7 |
Rabbit Polyclonal SIRT7 Antibody
Applications | IP, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | Synthetic peptide made to an internal portion of the human protein (within residues 200-300). [Swiss-Prot# Q9NRC8] |
Rabbit Polyclonal SIRT7 Antibody
Applications | IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the human protein (within residues 100-200). [Swiss-Prot# Q9NRC8] |
Rabbit Polyclonal Anti-SIRT7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SIRT7 antibody: synthetic peptide directed towards the middle region of human SIRT7. Synthetic peptide located within the following region: GEEGSHSRKSLCRSREEAPPGDRGAPLSSAPILGGWFGRGCTKRTKRKKV |
Rabbit Polyclonal Anti-SIRT7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SIRT7 antibody: synthetic peptide directed towards the C terminal of human SIRT7. Synthetic peptide located within the following region: DVMRLLMAELGLEIPAYSRWQDPIFSLATPLRAGEEGSHSRKSLCRSREE |
Rabbit Polyclonal SIRT7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A mixture of synthetic peptides corresponding to amino acids 35-51 and 361-377 of human SIRT7 was used as immunogen. |
Anti-SIRT7 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 90-331 amino acids of human sirtuin 7 |
SIRT7 Antibody - middlel region
Applications | WB |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse SIRT7 |