Germany
Japan
United Kingdom
China
TBK1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TBK1 |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-TBK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBK1 antibody: synthetic peptide directed towards the N terminal of human TBK1. Synthetic peptide located within the following region: EEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGM |
Rabbit Polyclonal Anti-TBK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBK1 antibody: synthetic peptide directed towards the middle region of human TBK1. Synthetic peptide located within the following region: QEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQ |
Phospho-TBK1/NAK-S172 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around S172 of human TBK1/NAK (NP_037386.1). |
| Modifications | Phospho S172 |
TBK1 Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Hamster, Human, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- TBK1
Applications
- WB
Antibody Hosts
- Rabbit