TBK1 Rabbit Polyclonal Antibody

CAT#: TA334469

Rabbit Polyclonal Anti-TBK1 Antibody

Product Images

WB Suggested Anti-TBK1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TBK1 antibody: synthetic peptide directed towards the middle region of human TBK1. Synthetic peptide located within the following region: QEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 84 kDa
• Gene Name: TANK binding kinase 1
• Database Link:
  NP_037386
  Entrez Gene 29110 Human
  UniProt ID Q9UHD2
• Background: The NF-kappa-B (NFKB) complex of proteins is inhibited by I-kappa-B (IKB) proteins, which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the IKB proteins by IKB kinases marks them for destruction via the ubiquitination pathway, thereby allowing activation and nuclear translocation of the NFKB complex. The protein encoded by this gene is similar to IKB kinases and can mediate NFKB activation in response to certain growth factors. [provided by RefSeq, Oct 2010]
• Synonyms: NAK; T2K
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway