Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-TLK2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TLK2 antibody: synthetic peptide directed towards the N terminal of human TLK2. Synthetic peptide located within the following region: VSAQQNSPSSTGSGNTEHSCSSQKQISIQHRQTQSDLTIEKISALENSKN

Rabbit Polyclonal Anti-TLK2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TLK2 antibody: synthetic peptide directed towards the N terminal of human TLK2. Synthetic peptide located within the following region: SNQSLCSVGSLSDKEVETPEKKQNDQRNRKRKAEPYETSQGKGTPRGHKI

Rabbit Polyclonal Anti-TLK2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TLK2

TLK2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human TLK2 (NP_006843.2).
Modifications Unmodified