Primary Antibodies

View as table Download

Rabbit polyclonal anti-ARG2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human ARG2.

Rabbit Polyclonal Anti-ARG2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ARG2 antibody: synthetic peptide directed towards the N terminal of human ARG2. Synthetic peptide located within the following region: LSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDH

Rabbit Polyclonal Anti-ARG2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ARG2 antibody: synthetic peptide directed towards the C terminal of human ARG2. Synthetic peptide located within the following region: SALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPT

ARG2 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse ARG2

Arginase 2 (ARG2) Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-354 of human Arginase 2 (Arginase 2 (ARG2)) (NP_001163.1).
Modifications Unmodified