ARG2 Rabbit Polyclonal Antibody

CAT#: TA335004

Rabbit Polyclonal Anti-ARG2 Antibody

Product Images

WB Suggested Anti-ARG2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysateARG2 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Host: Rabbit; Target Name: ARG2; Sample Tissue: Jurkat; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 1 ug/ml; Peptide Concentration: 5 ug/ml; Lysate Quantity: 25 ug/lane/lane; Gel Concentration: 0.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ARG2 antibody: synthetic peptide directed towards the C terminal of human ARG2. Synthetic peptide located within the following region: SALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: arginase 2
• Database Link:
  NP_001163
  Entrez Gene 11847 MouseEntrez Gene 384 Human
  UniProt ID P78540
• Background: Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exists (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. ARG2 (type II isoform) is located in the mitochondria and expressed in extra-hepatic tissues, especially kidney. The physiologic role of this isoform is poorly understood; it is thought to play a role in nitric oxide and polyamine metabolism.Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exists (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type II isoform encoded by this gene, is located in the mitochondria and expressed in extra-hepatic tissues, especially kidney. The physiologic role of this isoform is poorly understood; it is thought to play a role in nitric oxide and polyamine metabolism. Transcript variants of the type II gene resulting from the use of alternative polyadenylation sites have been described. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: arginase; arginase 2; kidney arginase; L-arginine amidinohydrolase; L-arginine ureahydrolase; nonhepatic arginase; type II
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%; Horse: 87%

Reference Data

• Protein Pathways: Arginine and proline metabolism, Metabolic pathways