Rabbit Polyclonal Anti-Drgx Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Prrxl1 antibody is: synthetic peptide directed towards the middle region of Rat Prrxl1. Synthetic peptide located within the following region: GAKEPMAEVTPPPVRNINSPPPGDQARGKKEALEAQQSLGRTVGPAGPFF |
Rabbit Polyclonal Anti-Drgx Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Prrxl1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Prrxl1. Synthetic peptide located within the following region: MFYFHCPPQLEGTAPFGNHSTGDFDDGFLRRKQRRNRTTFALQQLEALEA |
Rabbit Polyclonal Anti-DRGX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DRGX antibody: synthetic peptide directed towards the N terminal of human DRGX. Synthetic peptide located within the following region: MVLMSCDQRLISLLLVGTATFGNHSSGDFDDGFLRRKQRRNRTTFTLQQL |
Rabbit Polyclonal Anti-DRGX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DRGX antibody: synthetic peptide directed towards the middle region of human DRGX. Synthetic peptide located within the following region: KEPMAEVTPPPVRNINSPPPGDQARSKKEALEAQQSLGRTVGPAGPFFPS |
DRGX rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human DRGX |
Germany
Japan
United Kingdom
China