Drgx Rabbit Polyclonal Antibody

CAT#: TA341735

Rabbit Polyclonal Anti-Drgx Antibody

Product Images

Host: Rabbit; Target Name: Prrxl1; Sample Tissue: Rat Pancreas lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Prrxl1 antibody is: synthetic peptide directed towards the middle region of Rat Prrxl1. Synthetic peptide located within the following region: GAKEPMAEVTPPPVRNINSPPPGDQARGKKEALEAQQSLGRTVGPAGPFF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: dorsal root ganglia homeobox
• Database Link:
  NP_665710
  Entrez Gene 252880 Rat
  UniProt ID Q62798
• Background: paired homeodomain protein; may be involved in regulating sensory neuron synapse formation [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: U29174.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SRS070537, SRS070538 [ECO:0000348] ##Evidence-Data-END##
• Synonyms: DRG11; PRRXL1
• Note: Immunogen Sequence Homology: Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Bovine: 93%; Rabbit: 93%; Rat: 91%