Drgx Rabbit Polyclonal Antibody
Other products for "Drgx"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Rat |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Prrxl1 antibody is: synthetic peptide directed towards the middle region of Rat Prrxl1. Synthetic peptide located within the following region: GAKEPMAEVTPPPVRNINSPPPGDQARGKKEALEAQQSLGRTVGPAGPFF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 28 kDa |
Gene Name | dorsal root ganglia homeobox |
Database Link | |
Background | paired homeodomain protein; may be involved in regulating sensory neuron synapse formation [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: U29174.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SRS070537, SRS070538 [ECO:0000348] ##Evidence-Data-END## |
Synonyms | DRG11; PRRXL1 |
Note | Immunogen Sequence Homology: Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Bovine: 93%; Rabbit: 93%; Rat: 91% |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.