FABP3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FABP3 |
FABP3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FABP3 |
Rabbit Polyclonal Anti-FABP3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the N terminal of human FABP3. Synthetic peptide located within the following region: NGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHL |
Rabbit Polyclonal Anti-FABP3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the middle region of human FABP3. Synthetic peptide located within the following region: MTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIV |
Rabbit Polyclonal Anti-FABP3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the middle region of human FABP3. Synthetic peptide located within the following region: DETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHG |
FABP3 (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human FABP3 |
Anti-FABP3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 95-108 amino acids of Human Fatty acid-binding protein 3 |
FABP3 Antibody - N-terminal region
Applications | WB |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse FABP3 |
FABP3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FABP3 |
FABP3 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-133 of human FABP3 (NP_004093.1). |
Modifications | Unmodified |