FABP3 Rabbit Polyclonal Antibody

CAT#: TA342387

Rabbit Polyclonal Anti-FABP3 Antibody

Product Images

WB Suggested Anti-FABP3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human heart

• 

  Immunohistochemistry with Skeletal muscle tissue

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the middle region of human FABP3. Synthetic peptide located within the following region: MTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 15 kDa
• Gene Name: fatty acid binding protein 3
• Database Link:
  NP_004093
  Entrez Gene 2170 Human
  UniProt ID P05413
• Background: The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. This gene is a candidate tumor suppressor gene for human breast cancer. [provided by RefSeq, Jul 2008]
• Synonyms: FABP11; H-FABP; M-FABP; MDGI; O-FABP
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 95%; Rat: 85%; Horse: 80%; Mouse: 80%; Dog: 75%; Pig: 75%; Guinea pig: 75%

Reference Data

• Protein Pathways: PPAR signaling pathway