Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-H6PD Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H6PD antibody: synthetic peptide directed towards the N terminal of human H6PD. Synthetic peptide located within the following region: HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLW

H6PD Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human H6PD (NP_004276.2).
Modifications Unmodified