H6PD Rabbit Polyclonal Antibody

CAT#: TA339891

Rabbit Polyclonal Anti-H6PD Antibody

Product Images

WB Suggested Anti-H6PD Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 721_B cell lysate H6PD is supported by BioGPS gene expression data to be expressed in 721_B

• 

  Rabbit Anti-H6PD Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue; Observed Staining: Cytoplasmic in alveolar type I cells; Primary Antibody Concentration: 1: 100; Other Working Concentrations: 1/600; Secondary Antibody: Donkey anti-Ra

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-H6PD antibody: synthetic peptide directed towards the N terminal of human H6PD. Synthetic peptide located within the following region: HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 89 kDa
• Gene Name: hexose-6-phosphate dehydrogenase/glucose 1-dehydrogenase
• Database Link:
  NP_004276
  Entrez Gene 9563 Human
  UniProt ID O95479
• Background: There are 2 forms of glucose-6-phosphate dehydrogenase. G form is X-linked and H form is autosomally linked. This H form shows activity with other hexose-6-phosphates, especially galactose-6-phosphate, whereas the G form is specific for glucose-6-phosphate. Both forms are present in most tissues, but H form is not found in red cells.There are 2 forms of glucose-6-phosphate dehydrogenase. G form is X-linked and H form, encoded by this gene, is autosomally linked. This H form shows activity with other hexose-6-phosphates, especially galactose-6-phosphate, whereas the G form is specific for glucose-6-phosphate. Both forms are present in most tissues, but H form is not found in red cells. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: CORTRD1; G6PDH; GDH
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%; Rabbit: 86%

Reference Data

• Protein Pathways: Metabolic pathways, Pentose phosphate pathway