TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
Rabbit Polyclonal H3K9/14ac Antibody
Applications | Dot, ELISA, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K9/14ac antibody: histone H3 acetylated at lysines 9 and 14 (H3K9/14ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K9me2 Antibody
Applications | Dot, ELISA, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K9me2 antibody: the region of histone H3 containing the dimethylated lysine 9 (H3K9me2), using a KLH-conjugated synthetic peptide. |
Rabbit Anti-NMDA NR2B Subunit Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit Polyclonal Anti-C4B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C4B antibody: synthetic peptide directed towards the N terminal of human C4B. Synthetic peptide located within the following region: QTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYM |
IL10 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated corresponding to the center region (between aa 27-53) of Human IL10. |
Anti-HLA-DRA Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 26-216 amino acids of human major histocompatibility complex, class II, DR alpha |