Primary Antibodies

Jump to Filters
View as table Download
PIG3 (TP53I3) Rabbit Polyclonal Antibody
TA308561

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to PIG3 (tumor protein p53 inducible protein 3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 332 of PIG3 (Uniprot ID#Q53FA7)
PIG3 (TP53I3) Rabbit Polyclonal Antibody
TA590395

USD 409.00

In Stock

Rabbit Polyclonal PIG3 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
PIG3 (TP53I3) Rabbit Polyclonal Antibody
TA338282

USD 375.00

5 Days

Rabbit Polyclonal Anti-TP53I3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53I3 antibody is: synthetic peptide directed towards the C-terminal region of Human TP53I3. Synthetic peptide located within the following region: SKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVL
PIG3 (TP53I3) Rabbit Polyclonal Antibody
TA358729

USD 360.00

5 Days

TP53I3 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
PIG3 (TP53I3) Rabbit Polyclonal Antibody
TA382737

USD 220.00

3 Weeks

TP53I3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 163-332 of human TP53I3 (NP_671713.1).
Modifications Unmodified