Primary Antibodies

Jump to Filters
View as table Download
KIR2.3 (KCNJ4) Rabbit Polyclonal Antibody
TA314129

USD 345.00

In Stock

Rabbit polyclonal anti-KCNJ4 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human KCNJ4.
Kcnj4 Rabbit Polyclonal Antibody
TA328941

USD 585.00

3 Weeks

Rabbit polyclonal Anti-Kir2.3

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)EFGS HLDLE RMQAA TLPLD N, corresponding to amino acid residues 418-437 of rat Kir2.3.Intracellular, C-terminal part.
KIR2.3 (KCNJ4) Rabbit Polyclonal Antibody
TA338549

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNJ4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNJ4 antibody: synthetic peptide directed towards the middle region of human KCNJ4. Synthetic peptide located within the following region: AVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI
KIR2.3 (KCNJ4) Rabbit Polyclonal Antibody
TA377723

USD 220.00

3 Weeks

KCNJ4 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human KCNJ4 (NP_004972.1).
Modifications Unmodified
KIR2.3 (KCNJ4) Rabbit Polyclonal Antibody
TA377724

USD 220.00

3 Weeks

KCNJ4 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 316-445 of human KCNJ4 (NP_690607.1).
Modifications Unmodified