Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-KLRC1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human KLRC1

Rabbit Polyclonal antibody to KLRC1 (killer cell lectin-like receptor subfamily C, member 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 45 of KLRC1 (Uniprot ID#P26715)

Rabbit polyclonal anti-KLRC1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human KLRC1.

Rabbit Polyclonal Anti-KLRC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLRC1 antibody: synthetic peptide directed towards the C terminal of human KLRC1. Synthetic peptide located within the following region: SHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKH

KLRC1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

KLRC1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KLRC1 antibody is: synthetic peptide directed towards the N-terminal region of Human NKG2A

KLRC1 rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human KLRC1

KLRC1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 96-215 of human KLRC1 (NP_015567.1).
Modifications Unmodified

CD159a/c Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from the Internal region of human KLRC1/2/3. AA range:101-150