NKG2A (KLRC1) Rabbit Polyclonal Antibody

CAT#: TA343145

Rabbit Polyclonal Anti-KLRC1 Antibody

Product Images

WB Suggested Anti-KLRC1 Antibody; Titration: 1.0 ug/ml; Positive Control: MCF7 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KLRC1 antibody: synthetic peptide directed towards the C terminal of human KLRC1. Synthetic peptide located within the following region: SHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: killer cell lectin like receptor C1
• Database Link:
  NP_015567
  Entrez Gene 3821 Human
  UniProt ID P26715
• Background: Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor family, also called NKG2 family, which is a group of transmembrane proteins preferentially expressed in NK cells. This family of proteins is characterized by the type II membrane orientation and the presence of a C-type lectin domain. This protein forms a complex with another family member, KLRD1/CD94, and has been implicated in the recognition of the MHC class I HLA-E molecules in NK cells. The genes of NKG2 family members form a killer cell lectin-like receptor gene cluster on chromosome 12. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed.
• Synonyms: CD159A; NKG2; NKG2A
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Antigen processing and presentation, Graft-versus-host disease, Natural killer cell mediated cytotoxicity