Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to KLRC1 (killer cell lectin-like receptor subfamily C, member 1)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 45 of KLRC1 (Uniprot ID#P26715) |
Rabbit polyclonal anti-KLRC1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human KLRC1. |
NKG2A (KLRC1) (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the C-term region of human KLRC1. |
Rabbit Polyclonal Anti-KLRC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLRC1 antibody: synthetic peptide directed towards the C terminal of human KLRC1. Synthetic peptide located within the following region: SHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKH |
KLRC1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
KLRC1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KLRC1 antibody is: synthetic peptide directed towards the N-terminal region of Human NKG2A |
KLRC1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 96-215 of human KLRC1 (NP_015567.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- KLRC1