Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-OCT2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-OCT2 Antibody: A synthesized peptide derived from human 41184

Anti-POU2F2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 200 amino acids of human POU class 2 homeobox 2

Rabbit polyclonal anti-OCT2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human OCT2 antibody.

Rabbit Polyclonal Anti-POU2F2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-POU2F2 Antibody: synthetic peptide directed towards the N terminal of human POU2F2. Synthetic peptide located within the following region: SPSEHTDTERNGPDTNHQNPQNKTSPFSVSPTGPSTKIKAEDPSGDSAPA

Rabbit anti OCT-2 Polyclonal Antibody

Applications Dot
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to C-terminus of OCT-2 protein from human, mouse and rat origins.

Anti-POU2F2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 200 amino acids of human POU class 2 homeobox 2

POU2F2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human POU2F2