Oct-2 (POU2F2) Rabbit Polyclonal Antibody

CAT#: TA335807

Rabbit Polyclonal Anti-POU2F2 Antibody

Product Images

WB Suggested Anti-POU2F2 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate. POU2F2 is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-POU2F2 Antibody: synthetic peptide directed towards the N terminal of human POU2F2. Synthetic peptide located within the following region: SPSEHTDTERNGPDTNHQNPQNKTSPFSVSPTGPSTKIKAEDPSGDSAPA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: POU class 2 homeobox 2
• Database Link:
  NP_002689
  Entrez Gene 5452 Human
  UniProt ID P09086
• Background: POU2F2 is a member of the POU family and is predominantly expressed in B cells, in activated T cells, and in the nervous system.
• Synonyms: Oct-2; OCT2; OTF2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 79%

Reference Data

• Protein Families: Transcription Factors