Primary Antibodies

View as table Download

Rabbit polyclonal COMT antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human COMT.

Rabbit Polyclonal Anti-COMT Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-COMT antibody: synthetic peptide directed towards the middle region of human COMT. Synthetic peptide located within the following region: PDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDH

Rabbit Polyclonal Anti-COMT Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen COMT antibody was raised against synthetic 19 amino acid peptide from internal region of human COMT. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (95%); Hamster, Rabbit (84%).

Rabbit Polyclonal Anti-COMT Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen COMT antibody was raised against synthetic 15 amino acid peptide from internal region of human COMT. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Marmoset, Rabbit (93%); Horse (87%); Mouse, Rat, Hamster, Bat, Pig (80%).

Rabbit Polyclonal Anti-COMT Antibody (N-Terminus)

Applications IHC
Reactivities Human
Immunogen COMT antibody was raised against synthetic 19 amino acid peptide from N-terminus of human COMT. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey (95%); Marmoset (89%); Hamster (84%).

Rabbit Polyclonal Anti-COMT Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen COMT antibody was raised against synthetic 15 amino acid peptide from internal region of human COMT. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bat, Bovine, Pig (100%); Hamster, Elephant, Panda, Rabbit, Horse (93%); Dog, Turkey, Chicken, Xenopus (87%).

Rabbit Polyclonal Anti-COMT Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen COMT antibody was raised against synthetic 19 amino acid peptide from internal region of human COMT. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla (100%); Orangutan, Gibbon, Rabbit (95%); Monkey, Marmoset, Horse (89%); Mouse, Rat, Hamster (84%).

Rabbit Polyclonal Anti-COMT Antibody (C-Terminus)

Applications IHC
Reactivities Human
Immunogen COMT antibody was raised against synthetic 19 amino acid peptide from C-terminus of human COMT. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (95%); Hamster, Rabbit (84%).