COMT Rabbit Polyclonal Antibody

CAT#: TA335255

Rabbit Polyclonal Anti-COMT Antibody

Product Images

WB Suggested Anti-COMT Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human Stomach

• 

  Lanes: 1. 100 ug Human lung microsome lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Secondary Antibody Dilution: 1: 10000; Gene Name: COMT; Submitted by: Jing Peng, Fox Chase Cancer Center;

• 

  COMT antibody - middle region validated by WB using rat liver, mouse lung, human brain at 1: 1000.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-COMT antibody: synthetic peptide directed towards the middle region of human COMT. Synthetic peptide located within the following region: PDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: catechol-O-methyltransferase
• Database Link:
  NP_000745
  Entrez Gene 12846 MouseEntrez Gene 24267 RatEntrez Gene 1312 Human
  UniProt ID P21964
• Background: Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways of the catecholamine transmitters. In addition to its role in the metabolism of endogenous substances, COMT is important in the metabolism of catechol drugs used in the treatment of hypertension, asthma, and Parkinson disease. COMT is found in two forms in tissues, a soluble form (S-COMT) and a membrane-bound form (MB-COMT). The differences between S-COMT and MB-COMT reside within the N-termini. Several transcript variants are formed through the use of alternative translation initiation sites and promoters. [provided by RefSeq, Sep 2008]
• Synonyms: HEL-S-98n
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%; Guinea pig: 92%; Rabbit: 86%; Dog: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Metabolic pathways, Tyrosine metabolism