Primary Antibodies

Jump to Filters
View as table Download
ETS2 (Center) Rabbit Polyclonal Antibody
AP51471PU-N

USD 450.00

2 Weeks

ETS2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 152~182 amino acids from the Central region of Human ETS2.
ETS2 Rabbit Polyclonal Antibody
TA343520

USD 375.00

5 Days

Rabbit Polyclonal Anti-ETS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ETS2 antibody: synthetic peptide directed towards the N terminal of human ETS2. Synthetic peptide located within the following region: NDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQE
ETS2 Rabbit Polyclonal Antibody
TA343521

USD 375.00

5 Days

Rabbit Polyclonal Anti-ETS2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ETS2 antibody: synthetic peptide directed towards the middle region of human ETS2. Synthetic peptide located within the following region: DPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVC
ETS2 Rabbit Polyclonal Antibody
TA349947

USD 345.00

In Stock

Rabbit Polyclonal Anti-ETS2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ETS2