Primary Antibodies

Jump to Filters
View as table Download
KIR2.3 (KCNJ4) Rabbit Polyclonal Antibody
TA314129

USD 345.00

In Stock

Rabbit polyclonal anti-KCNJ4 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human KCNJ4.
KIR2.3 (KCNJ4) (N-term) Rabbit Polyclonal Antibody
AP52311PU-N

USD 450.00

2 Weeks

KIR2.3 (KCNJ4) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human KCNJ4
KIR2.3 (KCNJ4) Rabbit Polyclonal Antibody
TA338549

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNJ4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNJ4 antibody: synthetic peptide directed towards the middle region of human KCNJ4. Synthetic peptide located within the following region: AVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI