Primary Antibodies

Jump to Filters
View as table Download
MAPK4 Rabbit Polyclonal Antibody
TA308559

USD 415.00

In Stock

Rabbit Polyclonal antibody to MAPK4 (mitogen-activated protein kinase 4)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 326 of MAPK4 (Uniprot ID#P31152)
MAPK4 (N-term) Rabbit Polyclonal Antibody
AP14039PU-N

USD 450.00

2 Weeks

MAPK4 (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 72-101 amino acids from the N-terminal region of Human MAPK4.
MAPK4 (C-term) Rabbit Polyclonal Antibody
AP14040PU-N

USD 450.00

2 Weeks

MAPK4 (C-term) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide at the C-term of human MAPK4.
MAPK4 Rabbit Polyclonal Antibody
TA342151

USD 375.00

5 Days

Rabbit polyclonal Anti-MAPK4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAPK4 antibody: synthetic peptide directed towards the middle region of human MAPK4. Synthetic peptide located within the following region: DFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDD