Primary Antibodies

View as table Download

Rabbit Monoclonal Antibody against YAP1 (Clone EP1675Y) (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Phospho-specific

Rabbit Monoclonal Antibody against YAP1 (Clone EP1674Y)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Antibody against YAP

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant YAP protein expressed in bacteria.

Rabbit polyclonal anti-YAP antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human YAP.

Rabbit Polyclonal YAP Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human YAP

Rabbit Polyclonal YAP (Ser127) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human YAP around the phosphorylation site of Serine 127
Modifications Phospho-specific

Rabbit Polyclonal Anti-YAP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-YAP1 antibody: synthetic peptide directed towards the C terminal of human YAP1. Synthetic peptide located within the following region: QLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDS

YAP1 (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human YAP1

YAP1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 103-133 amino acids from the Central region of human YAP