Primary Antibodies

View as table Download

PAX4 (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the ?-terminal region of human PAX4 Antibody (Center).

Rabbit Polyclonal Anti-PAX4 Antibody

Applications WB
Reactivities Human, Rat
Immunogen The immunogen for anti-PAX4 antibody: synthetic peptide directed towards the middle region of human PAX4. Synthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA

Rabbit Polyclonal Anti-PAX4 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-PAX4 antibody: synthetic peptide directed towards the N terminal of human PAX4. Synthetic peptide located within the following region: ISRILKVSNGCVSKILGRYYRTGVLEPKGIGGSKPRLATPPVVARIAQLK