Primary Antibodies

View as table Download

GHRHR (C-term) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide from Human GHRHR.
Epitope: C-Terminus.

Rabbit polyclonal anti-GHRHR antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GHRHR.

Rabbit Polyclonal Anti-GHRHR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GHRHR antibody: synthetic peptide directed towards the N terminal of human GHRHR. Synthetic peptide located within the following region: VTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEE

Rabbit Polyclonal Anti-GHRHR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GHRHR antibody: synthetic peptide directed towards the middle region of human GHRHR. Synthetic peptide located within the following region: PYPVACPVPLELLAEEESYFSTVKIIYTVGHSISIVALFVAITILVALRR

Rabbit Polyclonal Anti-GHRHR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GHRHR antibody: synthetic peptide directed towards the C terminal of human GHRHR. Synthetic peptide located within the following region: YWWIIKGPIVLSVGVNFGLFLNIIRILVRKLEPAQGSLHTQSQYWYCVFV

Rabbit Polyclonal Anti-GHRHR Antibody (N-Terminus)

Applications IHC
Reactivities Human
Immunogen GHRHR antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human GHRHR. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Marmoset, Panda, Dog (94%); Zebu, Bovine (89%); Rabbit, Pig (83%).

Rabbit Polyclonal Anti-GHRHR Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Immunogen GHRHR antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human GHRHR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Elephant (94%); Panda, Bat, Horse, Pig (88%); Marmoset, Zebu, Bovine, Dog (81%).

Rabbit Polyclonal Anti-GHRHR Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GHRHR antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GHRHR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Mouse, Rat, Hamster, Elephant, Zebu, Rabbit, Pig (94%); Panda, Bovine, Dog, Horse (88%).