Primary Antibodies

View as table Download

CLIC1 rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen This antibody is generated from rabbits immunized with a recombinant human CLIC1 protein.

Rabbit Polyclonal Anti-CLIC1

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide (C)RGFTIPEAFRGVHR, corresponding to amino acid residues 195-208 of human CLIC1. Intracellular, C-terminus.

Rabbit Polyclonal Anti-CLIC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CLIC1 antibody: synthetic peptide directed towards the N terminal of human CLIC1. Synthetic peptide located within the following region: GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIF

Rabbit polyclonal anti-CLIC1 antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CLIC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 136-166 amino acids from the Central region of human CLIC1.

Rabbit Polyclonal Anti-CLIC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLIC1 antibody: synthetic peptide directed towards the C terminal of human CLIC1. Synthetic peptide located within the following region: LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST

Rabbit Polyclonal Anti-CLIC1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CLIC1 antibody: synthetic peptide directed towards the C terminal of human CLIC1. Synthetic peptide located within the following region: LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST

Rabbit Polyclonal Anti-CLIC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CLIC1