CLIC1 Rabbit Polyclonal Antibody

CAT#: TA338517

Rabbit Polyclonal Anti-CLIC1 Antibody

Product Images

Lanes: ; Lane 1: 30ug mouse renal epithelial lysate; Lane 2: 30ug mouse renal epithelial lysate; Lane 3: 30ug mouse renal epithelial lysate; Primary Antibody Dilution: ; 1:500; Secondary Antibody: ; Anti-rabbit-HRP; Secondary Antibody Dilution: ; 1:2500;

• 

  WB Suggested Anti-CLIC1 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate

• 

  Sample Type: Purified Recombinant CLIC-1 Protein Primary Dilution: 1:1000Submitted By: Harpreet Singh, University of California Los Angeles

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CLIC1 antibody: synthetic peptide directed towards the N terminal of human CLIC1. Synthetic peptide located within the following region: GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: chloride intracellular channel 1
• Database Link:
  NP_001279
  Entrez Gene 114584 MouseEntrez Gene 1192 Human
  UniProt ID O00299
• Background: Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity. [provided by RefSeq, Jul 2008]
• Synonyms: G6; NCC27
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other