Primary Antibodies

View as table Download

Dysadherin (FXYD5) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 71-100 amino acids from the Central region of Human Dysadherin / FXYD5

Rabbit polyclonal Anti-FXYD5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FXYD5 antibody: synthetic peptide directed towards the N terminal of human FXYD5. Synthetic peptide located within the following region: LQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDD

Rabbit Polyclonal Anti-FXYD5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FXYD5 antibody: synthetic peptide directed towards the middle region of human FXYD5. Synthetic peptide located within the following region: SERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKRGLLVAAVLFITG

Rabbit Polyclonal Anti-FXYD5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FXYD5 antibody: synthetic peptide directed towards the middle region of human FXYD5. Synthetic peptide located within the following region: DETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPST