Dysadherin (FXYD5) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 71-100 amino acids from the Central region of Human Dysadherin / FXYD5 |
Dysadherin (FXYD5) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 71-100 amino acids from the Central region of Human Dysadherin / FXYD5 |
Rabbit polyclonal Anti-FXYD5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FXYD5 antibody: synthetic peptide directed towards the N terminal of human FXYD5. Synthetic peptide located within the following region: LQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDD |
Rabbit Polyclonal Anti-FXYD5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FXYD5 antibody: synthetic peptide directed towards the middle region of human FXYD5. Synthetic peptide located within the following region: SERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKRGLLVAAVLFITG |
Rabbit Polyclonal Anti-FXYD5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FXYD5 antibody: synthetic peptide directed towards the middle region of human FXYD5. Synthetic peptide located within the following region: DETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPST |