Dysadherin (FXYD5) Rabbit Polyclonal Antibody

CAT#: TA331461

Rabbit polyclonal Anti-FXYD5 Antibody

Product Images

WB Suggested Anti-FXYD5 Antibody Titration: 0.625ug/ml; ELISA Titer: 1:312500; Positive Control: Human Placenta

• 

  Lanes: Lane 1: 10ug hFXYD5 transfected 293T lysate; Lane 2: 10ug 293T lysate; Primary Antibody Dilution: 1:1000; Secondary Antibody: Anti-rabbit HRP; Secondary Antibody Dilution: 1:4000; Gene Name: FXYD5; Submitted by: Anonymous;

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FXYD5 antibody: synthetic peptide directed towards the N terminal of human FXYD5. Synthetic peptide located within the following region: LQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: FXYD domain containing ion transport regulator 5
• Database Link:
  NP_659003
  Entrez Gene 53827 Human
  UniProt ID Q96DB9
• Background: FXYD5 is a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIon Channel (Related to Ion Channel). FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIon Channel) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. This gene product, FXYD5, has not been characterized as a protein.
• Synonyms: DYSAD; HSPC113; IWU1; KCT1; OIT2; PRO6241; RIC
• Note: Human: 100%; Mouse: 100%; Yeast: 90%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other, Transmembrane