Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-KCNN2 Antibody

Applications IHC, WB
Reactivities Human, Rat, Rhesus macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNN2 antibody: synthetic peptide directed towards the C terminal of human KCNN2. Synthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM

KCNN2 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Monkey, Orang-Utan
Immunogen KCNN2 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human KCNN2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Hamster, Panda, Dog, Horse, Guinea pig (94%); Marmoset, Rat, Elephant, Bat (89%); Mouse, Pig (83%).

Rabbit Polyclonal Anti-KCNN2 Antibody

Applications WB
Reactivities Human, Rhesus macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNN2 antibody: synthetic peptide directed towards the middle region of human KCNN2. Synthetic peptide located within the following region: KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ