KCNN2 Rabbit Polyclonal Antibody

CAT#: TA338526

Rabbit Polyclonal Anti-KCNN2 Antibody

Product Images

WB Suggested Anti-KCNN2 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate

• 

  Host: Rabbit; Target Name: KCNN2; Sample Tissue: HepG2; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide ; Primary Antibody Concentration:2.5ug/mL; Peptide Concentration: 2.0ug/mL; Lysate Quantity: 25ug/lane; Gel Concentration: 12%

• 

  Lanes: ; Rat brain section; Primary Antibody Dilution: 1:500; Secondary Antibody: Anti-rabbit-biotin, streptavidin-diaminobenzidine; Secondary Antibody Dilution: 1:500; Gene Name: KCNN2; Submitted by: Dr. Amiel Rosenkranz, Rosalind Franklin University;

• 

  Sample Type. Rhesus macaque spinal cordPrimary Antibody Dilution. 1:300 Secondary Antibody. Donkey anti Rabbit 488Secondary Antibody Dilution. 1:500Color/Signal Descriptions. Green: KCNN2Gene Name. KCNN2Submitted by. Timur Mavlyutov, Ph. D., Depart

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human, Rat, Rhesus macaque
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KCNN2 antibody: synthetic peptide directed towards the C terminal of human KCNN2. Synthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: potassium calcium-activated channel subfamily N member 2
• Database Link:
  NP_067627
  Entrez Gene 54262 RatEntrez Gene 3781 Human
  UniProt ID Q9H2S1
• Background: Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by this gene is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. This gene is a member of the KCNN family of potassium channel genes. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. Alternate splicing of this gene results in multiple transcript variants. [provided by RefSeq, May 2013]
• Synonyms: hSK2; KCa2.2; SK2; SKCA2; SKCa 2
• Note: Immunogen Sequence Homology: Human: 100%; Yeast: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Potassium, Transmembrane