Rabbit polyclonal anti-Alpha-Amylase antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 492 of human a-Amylase. |
Rabbit polyclonal anti-Alpha-Amylase antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 492 of human a-Amylase. |
Rabbit polyclonal anti-Alpha-Amylase antibody
Applications | WB |
Reactivities | Chicken, Human, Mouse, Rat, Pig |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 273 of rat a-Amylase |
Rabbit Polyclonal Anti-Amy1a Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Immunogen | The immunogen for anti-Amy1a antibody is: synthetic peptide directed towards the middle region of Rat Amy1a. Synthetic peptide located within the following region: YLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKMAV |
AMY1A Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 16-200 of human AMY1A (NP_004029.2). |
Modifications | Unmodified |
AMY1A Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 16-200 of human AMY1A (NP_004029.2). |
Modifications | Unmodified |