Amy1a Rabbit Polyclonal Antibody

CAT#: TA335064

Rabbit Polyclonal Anti-Amy1a Antibody

Product Images

Host: Rabbit; Target Name: Amy1a; Sample Tissue: Rat Heart lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Amy1a antibody is: synthetic peptide directed towards the middle region of Rat Amy1a. Synthetic peptide located within the following region: YLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKMAV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: amylase, alpha 1A (salivary)
• Database Link:
  NP_001010970
  Entrez Gene 24203 Rat
• Background: The function of this protein remains unknown.
• Synonyms: alpha-amylase; AMY1; AMY1B; glycogenase
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%