Amy1a Rabbit Polyclonal Antibody

CAT#: TA335064

Rabbit Polyclonal Anti-Amy1a Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Amy1a"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse, Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Amy1a antibody is: synthetic peptide directed towards the middle region of Rat Amy1a. Synthetic peptide located within the following region: YLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKMAV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 57 kDa
Gene Name amylase, alpha 1A (salivary)
Background The function of this protein remains unknown.
Synonyms alpha-amylase; AMY1; AMY1B; glycogenase
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.