Primary Antibodies

View as table Download

Rabbit anti-NDRG1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NDRG1

Rabbit Polyclonal Anti-NDRG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDRG1 antibody: synthetic peptide directed towards the C terminal of human NDRG1. Synthetic peptide located within the following region: GSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGA

Rabbit Polyclonal Anti-NDRG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDRG1 antibody: synthetic peptide directed towards the N terminal of human NDRG1. Synthetic peptide located within the following region: MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCG

Anti-NDRG1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 381-394 amino acids of human N-myc downstream regulated 1

Phospho-NDRG1-T346 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around T346 of human NDRG1 (NP_001128714.1).
Modifications Phospho T346

Phospho-NDRG1-S330 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around S330 of human NDRG1 (NP_001128714.1).
Modifications Phospho S330