Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-RORC Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RORC antibody is: synthetic peptide directed towards the N-terminal region of Human RORC. Synthetic peptide located within the following region: MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEG

Rabbit polyclonal anti-RORG antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RORG.

Rabbit Polyclonal Anti-RORC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORC antibody: synthetic peptide directed towards the N terminal of human RORC. Synthetic peptide located within the following region: EPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS

Rabbit Polyclonal Anti-RORC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RORC Antibody: synthetic peptide directed towards the C terminal of human RORC. Synthetic peptide located within the following region: DEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILA

Rabbit Polyclonal Anti-RORC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RORC Antibody: synthetic peptide directed towards the middle region of human RORC. Synthetic peptide located within the following region: CHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPD

Rabbit Polyclonal Anti-Rorc Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Rorc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSRGADTLTYTLG

RORC Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-320 of human RORC (NP_005051.2).
Modifications Unmodified