ROR gamma (RORC) Rabbit Polyclonal Antibody

CAT#: TA342287

Rabbit Polyclonal Anti-Rorc Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "RORC"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Rorc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSRGADTLTYTLG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 58 kDa
Gene Name RAR related orphan receptor C
Background Rorc is an orphan nuclear receptor. Isoform 2 negatively regulates expression of TNFSF6/FASL and IL2 production in T-cells. It also binds to the TEA promoter and may participate in the regulation of DNA accessibility in the TCR-Jalpha locus.
Synonyms NR1F3; RORG; RZR-GAMMA; RZRG; TOR
Note Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Dog: 85%; Pig: 79%; Human: 79%; Guinea pig: 79%
Reference Data
Protein Families Druggable Genome, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.