ROR gamma (RORC) Rabbit Polyclonal Antibody

CAT#: TA342287

Rabbit Polyclonal Anti-Rorc Antibody

Product Images

WB Suggested Anti-Rorc Antibody Titration: 1 ug/ml; Positive Control: Mouse Heart lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Rorc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSRGADTLTYTLG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: RAR related orphan receptor C
• Database Link:
  NP_005051
  Entrez Gene 19885 Mouse
  UniProt ID P51449
• Background: Rorc is an orphan nuclear receptor. Isoform 2 negatively regulates expression of TNFSF6/FASL and IL2 production in T-cells. It also binds to the TEA promoter and may participate in the regulation of DNA accessibility in the TCR-Jalpha locus.
• Synonyms: NR1F3; RORG; RZR-GAMMA; RZRG; TOR
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Dog: 85%; Pig: 79%; Human: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors