Primary Antibodies

View as table Download

Rabbit polyclonal MEK2 (MAP2K2) Antibody (Center)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This MEK2 (MAP2K2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-292 amino acids from the Central region of human MEK2 (MAP2K2).

Rabbit Polyclonal B-RAF Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human B-RAF

Rabbit Polyclonal B-RAF (Ser446) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human B-RAF around the phosphorylation site of Serine 446
Modifications Phospho-specific

Rabbit Polyclonal Cyclin D1 Antibody

Applications WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cyclin D1 around the phosphorylation site of Thr286.

Rabbit Polyclonal Cyclin D1 (Ser90) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Cyclin D1 around the phosphorylation site of Serine 90
Modifications Phospho-specific

Rabbit Polyclonal Catenin-β Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Catenin-β

Rabbit Polyclonal Catenin- beta (Ser33) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Catenin- beta around the phosphorylation site of Serine 33
Modifications Phospho-specific

Rabbit Polyclonal Catenin- beta (Tyr489) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Catenin- beta around the phosphorylation site of Tyrosine 489
Modifications Phospho-specific

Rabbit Polyclonal Catenin-β (Ser37) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Catenin-β around the phosphorylation site of Serine 37
Modifications Phospho-specific

Rabbit Polyclonal MEK1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MEK1

Rabbit Polyclonal MEK1/2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MEK1/2

Rabbit Polyclonal MEK1/2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MEK1/2

Rabbit Polyclonal MEK1 (Thr291) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MEK1 around the phosphorylation site of Threonine 291
Modifications Phospho-specific

Rabbit Polyclonal MEK1/2 (Ser217) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MEK1/2 around the phosphorylation site of Serine 217
Modifications Phospho-specific

Rabbit Polyclonal MEK1/2 (Ser221) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MEK1/2 around the phosphorylation site of Serine 221
Modifications Phospho-specific

Rabbit Polyclonal MEK2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MEK2

Rabbit Polyclonal MEK2 (Thr394) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MEK2 around the phosphorylation site of Threonine 394
Modifications Phospho-specific

Rabbit Polyclonal ERK1/2 (Tyr204) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Tyrosine 204
Modifications Phospho-specific

Rabbit Polyclonal p44/42 MAP Kinase (Thr202) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p44/42 MAP Kinase around the phosphorylation site of Threonine 202
Modifications Phospho-specific

Rabbit Polyclonal C-myc antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human C-myc

Rabbit Polyclonal Myc (Thr58) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Myc around the phosphorylation site of Threonine 58
Modifications Phospho-specific

Rabbit Polyclonal p53 (Ser315) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 315
Modifications Phospho-specific

Rabbit Polyclonal p53 (Ser366) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 366
Modifications Phospho-specific

Rabbit Polyclonal p53 (Ser46) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 46
Modifications Phospho-specific

Rabbit Polyclonal p53 (Ser9) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 9
Modifications Phospho-specific

Rabbit polyclonal B-Raf (Phospho-Thr753) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human B-Raf around the phosphorylation site of threonine 753 (P-K-TP-P-I).
Modifications Phospho-specific

Rabbit polyclonal B-Raf (Ab-753) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human B-Raf around the phosphorylation site of threonine 735 (P-K-TP-P-I).

Rabbit polyclonal p53 (Ab-46) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human p53 around the phosphorylation site of Serine 46.

Rabbit polyclonal p42 MAPK antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human p42 MAPK.

Rabbit polyclonal p53 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human p53.

Rabbit polyclonal p53 (Phospho-Thr387) antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of threonine 387 (F-K-TP-E-G).
Modifications Phospho-specific

Rabbit polyclonal B-RAF (Phospho-Thr599) antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human B-Raf around the phosphorylation site of threonine 598 (L-A-TP-V-K).
Modifications Phospho-specific

Rabbit polyclonal MAPK1/3 (Phospho-Tyr205/222) antibody

Applications WB
Reactivities Human: Tyr205/222, Mouse: Tyr203/223, Rat: Tyr203/223
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human MAPK1 around the phosphorylation site of tyrosine 204.
Modifications Phospho-specific

Rabbit polyclonal p53 (Phospho-Ser46) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of Serine 46.
Modifications Phospho-specific

Rabbit polyclonal p53 (Ab-378) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human p53 around the phosphorylation site of serine 378 (S-T-SP-R-H).

Rabbit polyclonal MAPK1/3 (Ab-205/222) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human MAPK1.

Rabbit polyclonal p44 MAPK antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human p44 MAPK.

Rabbit Polyclonal B-RAF Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human B-RAF

Rabbit Polyclonal PPAR-gamma Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PPAR-gamma

Rabbit Polyclonal Phospho-B-RAF (Thr599) Antibody (Phospho-specific)

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human B-RAF around the phosphorylation site of Threonine 599.
Modifications Phospho-specific

Rabbit Polyclonal anti-TP53 antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

Rabbit Polyclonal anti-TP53 antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

Rabbit Polyclonal Anti-LEF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the C terminal of human LEF1. Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ

Rabbit Polyclonal E-Cadherin Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal E-Cadherin Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal E-Cadherin Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

ERK1 (MAPK3) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat

PAX8 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

MEK1 (MAP2K1) (+MAP2K2) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

beta Catenin (CTNNB1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated