Primary Antibodies

Jump to Filters
View as table Download
PECI (ECI2) Rabbit Polyclonal Antibody
TA346747

USD 475.00

5 Days

Rabbit Polyclonal Anti-PECI Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PECI antibody: synthetic peptide directed towards the middle region of human PECI. Synthetic peptide located within the following region: AVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAK
PECI (ECI2) Rabbit Polyclonal Antibody
TA312299

USD 345.00

4 Weeks

Rabbit polyclonal anti-PECI antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PECI.
PECI (ECI2) (C-term) Rabbit Polyclonal Antibody
AP18149PU-N

USD 450.00

2 Weeks

PECI (ECI2) (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human PECI