Rabbit anti-NRF1 Polyclonal Antibody
Applications | ChIP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NRF1 |
Rabbit anti-NRF1 Polyclonal Antibody
Applications | ChIP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NRF1 |
Rabbit polyclonal anti-NRF1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NRF1. |
Rabbit Polyclonal Anti-NRF1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NRF1 Antibody is: synthetic peptide directed towards the middle region of Human NRF1. Synthetic peptide located within the following region: WATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVTMALNSE |
Rabbit Polyclonal Anti-NRF1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NRF1 antibody: synthetic peptide directed towards the C terminal of human NRF1. Synthetic peptide located within the following region: IVLSGETAAAVGALTGVQDANGLFMADRAGRKWILTDKATGLVQIPVSMY |
Rabbit Polyclonal Anti-NRF1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NRF1 antibody: synthetic peptide directed towards the N terminal of human NRF1. Synthetic peptide located within the following region: MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPED |
Rabbit Polyclonal Anti-NRF1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NRF1 |