Primary Antibodies

View as table Download

MAT2B (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 86~116 amino acids from the N-terminal region of human MAT2B

Rabbit polyclonal Anti-MAT2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAT2B antibody: synthetic peptide directed towards the N terminal of human MAT2B. Synthetic peptide located within the following region: KEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAA

Rabbit polyclonal Anti-MAT2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAT2B antibody: synthetic peptide directed towards the middle region of human MAT2B. Synthetic peptide located within the following region: GNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGE