MAT2B Rabbit Polyclonal Antibody

CAT#: TA342139

Rabbit polyclonal Anti-MAT2B Antibody

Product Images

WB Suggested Anti-MAT2B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MAT2B antibody: synthetic peptide directed towards the middle region of human MAT2B. Synthetic peptide located within the following region: GNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: methionine adenosyltransferase 2B
• Database Link:
  NP_037415
  Entrez Gene 27430 Human
  UniProt ID Q9NZL9
• Background: The protein encoded byThis gene belongs toThe methionine adenosyltransferase (MAT) family. MAT catalyzesThe biosynthesis of S-adenosylmethionine from methionine and ATP.This protein isThe regulatory beta subunit of MAT. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Nov 2012]
• Synonyms: MAT-II; MATIIbeta; Nbla02999; SDR23E1; TGR
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 91%

Reference Data

• Protein Pathways: Cysteine and methionine metabolism, Metabolic pathways, Selenoamino acid metabolism